Protein coding transcript 185800

• Transcript: Ll_transcript_2536
• CDS coordinates: 234-701 (+)
• Peptide sequence: MASPSGTSSGSSTLLHNSGSEEDERKRKRMISNRESARRSRMKKQKHLDELGAQVAQLNNENNQLLTTLNLATQRYLTIEAQNSVLRAQVGELSHRLDSLNQIIGFFNASNVDFEAANYASTTFIHPALNNFFNPFNMNPMTQPIMASAEAMLQY*
• ORF Type: complete

Annotations of Ll_transcript_2536

• Blastp: bZIP transcription factor 44 from Arabidopsis with 51.59% of identity
• Blastx: bZIP transcription factor 11 from Arabidopsis with 64.77% of identity
• Eggnog: Ocs element-binding factor(ENOG410ZM7Q)
• Kegg: Link to kegg annotations (AT1G75390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416494.1)
• Pfam: Basic region leucine zipper (PF07716.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;