Protein coding transcript 195752

• Transcript: Ll_transcript_137818
• CDS coordinates: 135-749 (+)
• Peptide sequence: MEIDPIPNGNNITVNLSPPPSSNLHQLADSLKLEHHFLRVPFEHFKKTLRTNHRAVEKDISAVISGINDAAVPHDAVNHLNSLVSRLQGLKRKLEEGSRAEHIQVQKCRVRINHLESADAENMSEWNNTRLKRILVDYMLRMSYYETAVKFAECSNIQDLVDIDVFQEAKTVMDALQNKDVSPALAWCAENKSRLKKTKVYTAV*
• ORF Type: complete

Annotations of Ll_transcript_137818

• Blastp: Macrophage erythroblast attacher from Danio with 35.68% of identity
• Blastx: Macrophage erythroblast attacher from Danio with 35.68% of identity
• Eggnog: Macrophage erythroblast attacher(ENOG410XPGU)
• Kegg: Link to kegg annotations (321575)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428745.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;