Protein coding transcript 196053

• Transcript: Ll_transcript_139349
• CDS coordinates: 87-728 (+)
• Peptide sequence: MQVSEIQQLQLQLQVKHHKQHNPNNQDIPMCQKKIQIQDEKKVIVEGDDFLVPPLNFAMVDSGIFRSGFPKPDNFSFLQTLRLRSIIYLCPEPYPETNLEFLKSNGIKLYQFGIEGHKEPFVNIPEDTIREALKVLLDVRNHPLIIHCKRGKHRTGCLVGCYRKLQKWCLSSVFDEYQRFAAAKARVSDQRFVELFDISSIKHLPIAFSCLKR*
• ORF Type: complete

Annotations of Ll_transcript_139349

• Blastp: Probable tyrosine-protein phosphatase At1g05000 from Arabidopsis with 77.19% of identity
• Blastx: Probable tyrosine-protein phosphatase At1g05000 from Arabidopsis with 77.19% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT1G05000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455867.1)
• Pfam: Tyrosine phosphatase family (PF03162.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;