Protein coding transcript 201851

• Transcript: Ll_transcript_125388
• CDS coordinates: 1582-1920 (+)
• Peptide sequence: MNLSFGSLEKRETNTSDMQLGRYMQSLRIWPLTFPSTSMYMVFHAVLDSLYLDLCCTLLSKDNLILSYFLHSAENLSPILHKYANEDVSLGAWFIGLEVEHIDERSMCCGTPP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_125388

• Blastp: Beta-1,3-galactosyltransferase 7 from Arabidopsis with 88.89% of identity
• Blastx: Beta-1,3-galactosyltransferase 7 from Arabidopsis with 75.93% of identity
• Eggnog: Beta-1,3-galactosyltransferase(ENOG410XV5H)
• Kegg: Link to kegg annotations (AT1G77810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020238233.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;