Protein coding transcript 202497

• Transcript: Ll_transcript_126497
• CDS coordinates: 520-1230 (+)
• Peptide sequence: MKRMDIFCASQASTAICLSMDPSASCSSSNTIQLGGKAIDRYNPIIISDSRRTTSKSLTTTTTTTCSSSSKLPIDPKPYHEQQNQKAKNKNSSSKPISQKKEKAIKGHDQKKKSIAEKVTEHVTNSYSSKPIDSVLRRSWFKPTSELFTPPGSTRCLLSDVTLVDGLSDNEPILALAMVNDKKKAQVVHQIETIHASKPSTSSLINSDSSEQVSSFISLCHSLHAHPRNIIRTLQS*
• ORF Type: complete

Annotations of Ll_transcript_126497

• Blastp: Protein SODIUM POTASSIUM ROOT DEFECTIVE 1 from Arabidopsis with 34.5% of identity
• Blastx: Protein SODIUM POTASSIUM ROOT DEFECTIVE 2 from Arabidopsis with 69.44% of identity
• Eggnog: heavy metal transport detoxification protein(COG2608)
• Kegg: Link to kegg annotations (AT5G02600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443024.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;