| Transcript | Ll_transcript_268661 |
|---|---|
| CDS coordinates | 1137-1529 (+) |
| Peptide sequence | MCRTLEVLARNQRERNDLGSQPLPMAIYVVSGDEDGERGGAPVVCIEDASRRCSEFSRGLAAWTPLLLLVPLVLGLDKINLRYVPLLQSTFKFPQSLGILGGKPGASTYIIGVQNEKAFYLDPHDVHPVC* |
| ORF Type | complete |
| Blastp | Cysteine protease ATG4 from Medicago with 87.6% of identity |
|---|---|
| Blastx | Cysteine protease ATG4 from Medicago with 70.37% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (MTR_7g081230) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019413861.1) |
| Pfam | Peptidase family C54 (PF03416.18) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer