Protein coding transcript 208635

• Transcript: Ll_transcript_71358
• CDS coordinates: 3-371 (+)
• Peptide sequence: RSGRELQRYNNMGGRQVVGCIPYRYKEDMDGNMSNEIELLVVSSQKGQALMFPKGGWEIDESLEEAACRESLEEAGVMGIVEVFDIYNKDILSQIMYQIMFLTDGNMSYQLKKLNIYNFFCF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_71358

• Blastp: Nudix hydrolase 17, mitochondrial from Arabidopsis with 64.89% of identity
• Blastx: Nudix hydrolase 17, mitochondrial from Arabidopsis with 64.89% of identity
• Eggnog: Nudix hydrolase(COG0494)
• Kegg: Link to kegg annotations (AT2G01670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420425.1)
• Pfam: NUDIX domain (PF00293.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;