Protein coding transcript 208823

• Transcript: Ll_transcript_71892
• CDS coordinates: 363-965 (+)
• Peptide sequence: MILIQRSLSLFCLELLLAVAKALRRVAEGKASAQAEAAVWKHKYELERERHLQFENRGKSCPELQPDHDDMRTNNPVNQHTPCNETKERSERCCSRNGICSHEVLRDGSPGSDSKMIRKASFKLSWCCKGDQSDQQKHDIVSFERGNITTAQRSSKQISLKWESNPQTVLILTKPNSVSVQILCAEMIRCESHYIICFYF*
• ORF Type: complete

Annotations of Ll_transcript_71892

• Blastp: NAD(H) kinase 1 from Arabidopsis with 53.89% of identity
• Blastx: NAD(H) kinase 1 from Arabidopsis with 82.52% of identity
• Eggnog: Catalyzes the phosphorylation of NAD to NADP. Utilizes ATP and other nucleoside triphosphates as well as inorganic polyphosphate as a source of phosphorus (By similarity)(COG0061)
• Kegg: Link to kegg annotations (AT3G21070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454316.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;