Protein coding transcript 209699

• Transcript: Ll_transcript_225955
• CDS coordinates: 1793-2461 (+)
• Peptide sequence: MSKEQLQSALEELQIRVGNAEAFADQKEEENTELKEQLKQSEERWAEYEAKMKSVEEAWQKQMASLQMSLVAARKSLASENGNVQPPIHGVTFPCYYDSEDATSMGSRTTGVSTPMKFMSGLCTSDGGRQGNGTLTTVSNLMKEFEQRRHNFDDEMKVLNEVKPAQQSANMNNLQQLLKLKHRFEGWKKQYKVRLQETKARLHKSEVGKSRRTWWEKVSSRA*
• ORF Type: complete

Annotations of Ll_transcript_225955

• Blastp: Myosin-2 from Arabidopsis with 49.77% of identity
• Blastx: Myosin-2 from Arabidopsis with 65.62% of identity
• Eggnog: myosin heavy chain(COG5022)
• Kegg: Link to kegg annotations (AT5G54280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435284.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;