Protein coding transcript 216583

• Transcript: Ll_transcript_154218
• CDS coordinates: 1266-1658 (+)
• Peptide sequence: MAVHDDCKLRFMELKAKRTYRFIVYKIEDKQVIVEKLGEPTQGYEDFTASLPADECRYAVYDFEYLTEGNVPKSRIFFIGWSPDTSRVRSKMIYASSKDRFKRELDGIQIELQATDPTEMGLDVFKSRAN*
• ORF Type: complete

Annotations of Ll_transcript_154218

• Blastp: Actin-depolymerizing factor 2 from Petunia with 83.33% of identity
• Blastx: Actin-depolymerizing factor 2 from Petunia with 84.06% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425470.1)
• Pfam: Cofilin/tropomyosin-type actin-binding protein (PF00241.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;