Protein coding transcript 219789

• Transcript: Ll_transcript_188811
• CDS coordinates: 169-813 (+)
• Peptide sequence: MKLINKLSPKRFFRSKKDRSVVSRSDPPSFGSESLSSSSEGSTHKTATGATGSQTPTSVLPDVSGDWTAISGDLHSDLANAFRFIDRDSDGVVSRHELEALLIRLAAAPEEVAMMLSEVEFDGEGCITVEALMNRVGSGSGSCENSDELMEAFAVFDTDRDGRISAEELFRIFEAIGDERCTLEECRRMIESVDRKGDGFVCFEDFSRMMELQR*
• ORF Type: complete

Annotations of Ll_transcript_188811

• Blastp: Probable calcium-binding protein CML36 from Arabidopsis with 51.15% of identity
• Blastx: Probable calcium-binding protein CML36 from Arabidopsis with 49.77% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (AT3G10190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426241.1)
• Pfam: EF hand (PF13202.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;