Protein coding transcript 223483

• Transcript: Ll_transcript_204427
• CDS coordinates: 721-1560 (+)
• Peptide sequence: MWRREMEWLLCVSDSIVELVPAVQQFPGGGTYEVMAMRPRSDLFINLPALKKLDGMLLGMLDGFEDTQFWYVDKGIILGDSKDCDDYNGRPSVRQEEKWWLPSAKVPPNGLSEIDRKRLQQCRDCTNQILKAAMAINSSVLAEMEIPRAYIGSLPKNGKACLGDIIYRYVTADQFSPECLLDCLDLSSEHHTLDVANRIEAAVHVWRLKDSKKHSNSVKARRSWGGKVKGLVANNERNHFLSQRAETLLQSLKHRFPGLPQTALDMAKIQYNKVHYLNL*
• ORF Type: complete

Annotations of Ll_transcript_204427

• Blastp: Rop guanine nucleotide exchange factor 1 from Arabidopsis with 74.09% of identity
• Blastx: Rop guanine nucleotide exchange factor 1 from Arabidopsis with 72.08% of identity
• Eggnog: rop guanine nucleotide exchange factor(ENOG4110DIX)
• Kegg: Link to kegg annotations (AT4G38430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413138.1)
• Pfam: PRONE (Plant-specific Rop nucleotide exchanger) (PF03759.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;