Transcript | Ll_transcript_352613 |
---|---|
CDS coordinates | 2-298 (+) |
Peptide sequence | EELRAKYNSDIQNEKPPTRVEALSAFIWNRYVAVTREQNESDEKRKLHVIVHAVNLRQKMEPPLPPNSFGNYYRFSMTIIPSFNNGDDEGHGLVKQVRE |
ORF Type | internal |
Blastp | Vinorine synthase from Rauvolfia with 42.03% of identity |
---|---|
Blastx | Vinorine synthase from Rauvolfia with 42.03% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (CAD89104) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438324.1) |
Pfam | Transferase family (PF02458.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer