Protein coding transcript 226504

• Transcript: Ll_transcript_172783
• CDS coordinates: 785-1300 (+)
• Peptide sequence: MHHTRMPLPLEMEEEPVYVNAKQYHGILRRRQSRAKAEVEKKVIKARKVWLISKLVGRGHCYDFFYNETEMKENSGKNKFCLKQQVTFCWISRNCAFIFLPSLYWEEKLTLIWFNIFQVMACIMLHISFLLPFILVLASYLIFLSMMYRYRQWKIIYHVLFAGLPILVSFS*
• ORF Type: complete

Annotations of Ll_transcript_172783

• Blastp: Nuclear transcription factor Y subunit A-9 from Arabidopsis with 72.55% of identity
• Blastx: Nuclear transcription factor Y subunit A-5 from Arabidopsis with 75.68% of identity
• Eggnog: Nuclear transcription factor Y(COG5224)
• Kegg: Link to kegg annotations (AT3G20910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449593.1)
• Pfam: CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B (PF02045.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;