Protein coding transcript 228165

• Transcript: Ll_transcript_99024
• CDS coordinates: 2374-3054 (+)
• Peptide sequence: MSGNGAMQFDAEYARWQEEQNRQINELRAAVNSHASDTELRMIIDGILAHYDEIFRLKGIAAKADVFHLLSGMWKTPAERCFLWLGGFRSSEVLKLLVNQLEPLTEQQVAGITNLQQSSQQAEDALSQGMDALQQSLAETLSTGSQNSSGSSGNVANYMGQMAMAMGKLGTLEGFIRQADNLRQQTLQQMHRILTTRQSARALLAIHDYFSRLRALSSLWLARPRD*
• ORF Type: complete

Annotations of Ll_transcript_99024

• Blastp: Transcription factor TGA2.2 from Oryza sativa with 85.4% of identity
• Blastx: Transcription factor TGA2.2 from Oryza sativa with 83.53% of identity
• Eggnog: Transcription factor(ENOG410YSUA)
• Kegg: Link to kegg annotations (4332660)
• CantataDB: Link to cantataDB annotations (CNT0000028)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413258.1)
• Pfam: Seed dormancy control (PF14144.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;