Protein coding transcript 237043

• Transcript: Ll_transcript_215470
• CDS coordinates: 549-974 (+)
• Peptide sequence: MVWAKGYKELIDLLAKHKSDLDGFNMDVFGSGEDANEVRMAARRLDLNLNFQNGRDHADDSLHGYKVFINPSVSDVLCTATAEALAMGKFVVCADHPSNEFFMSFPNCLTYKTSDDFVEKVKEALENEPHPLTPGQRYQLSW
• ORF Type: 3prime_partial

Annotations of Ll_transcript_215470

• Blastp: Digalactosyldiacylglycerol synthase 1, chloroplastic from Soja with 89.44% of identity
• Blastx: Digalactosyldiacylglycerol synthase 1, chloroplastic from Soja with 92.25% of identity
• Eggnog: Digalactosyldiacylglycerol synthase(ENOG410YBC3)
• Kegg: Link to kegg annotations (548059)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444218.1)
• Pfam: Glycosyl transferases group 1 (PF00534.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;