Protein coding transcript 238462

• Transcript: Ll_transcript_215654
• CDS coordinates: 698-1189 (+)
• Peptide sequence: MWDLNDSPDQRYDNKGKGVGSVSNSSSSAVVIEDDGSDEELKKRSSKIFGFSVTHDGGGDDDESMDSDNLPVTQQFFPVEEESEVTVPSGEGGSSSNFPRAHWVGVKFCQSEGLGGGKSVEMSQPMKKSRRGPRSRSSQYRGVTFYRRTGRWESHIWLVLYEP*
• ORF Type: complete

Annotations of Ll_transcript_215654

• Blastp: Floral homeotic protein APETALA 2 from Arabidopsis with 50.85% of identity
• Blastx: Floral homeotic protein APETALA 2 from Arabidopsis with 60.5% of identity
• Eggnog: floral homeotic protein APETALA(ENOG410YBZ8)
• Kegg: Link to kegg annotations (AT4G36920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422015.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;