Protein coding transcript 243372

• Transcript: Ll_transcript_135995
• CDS coordinates: 209-682 (+)
• Peptide sequence: MSQDTEMKDNPTTPPQSLPPPPPSTLHHLKEIASVIENGSKSNEVRRIGRAVRLTIALRKRLTASVLSSFIDFALIPGSDPHPMLSSYLHKEDDQAMETDTAISVAQTQGKQLSPELEIYCYFVVLLFLIDHKRYNEVGYFRVIFLSTMPMDGCFYV*
• ORF Type: complete

Annotations of Ll_transcript_135995

• Blastp: 26S proteasome non-ATPase regulatory subunit 3 homolog B from Arabidopsis with 61.59% of identity
• Blastx: Probable 26S proteasome non-ATPase regulatory subunit 3 from Daucus sect. Daucus with 71.06% of identity
• Eggnog: 26S proteasome nonATPase regulatory subunit(ENOG410XS40)
• Kegg: Link to kegg annotations (AT1G75990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435011.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;