Protein coding transcript 24502

• Transcript: Ll_transcript_389979
• CDS coordinates: 114-725 (+)
• Peptide sequence: MEPRVGNKFRLGRKLGSGSFGEIYLATNIQTNEEVAVKLEKAKTKHPQLLYESKLYKILQGGTGIPNVRWFGVEGEYNVLVMDLLGSSLEDLFNFCSRKLSLKTVLMLADQMINRVEYVHSKSYLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDNSTHQHIPYRENRNLTGTARYASMNTHLGIEQSRRDDLESLGFVLM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_389979

• Blastp: Casein kinase 1-like protein 1 from Arabidopsis with 88.73% of identity
• Blastx: Casein kinase 1-like protein 1 from Arabidopsis with 88.73% of identity
• Eggnog: Casein Kinase(ENOG410XPGP)
• Kegg: Link to kegg annotations (AT4G26100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448236.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;