Protein coding transcript 247988

• Transcript: Ll_transcript_212019
• CDS coordinates: 466-1464 (+)
• Peptide sequence: MGGICSRKRDQQVIEDDFRRGVFGRYCRNASTKWLGARSLRSKANHCPGGGSIPSLMELCIYKIREDFSKYNSFSILPRDISQQIFNELVDSHCLTEASLEAFRDCALQDVYLGEYPGVDDGWMDVISSQGSSLLAVDLSDSHVTDNGLRLLKVCSNLQALTLNYCDQFSEHWLKHISGLSNLTSLSIRKSSSVTPDGMRAFSSLVNLEKLDLERCSEIHGGFVHLKGLKKLQSLNIGCCKCVMDSDMKAISGLINLKELQISNSSVTDLGITYLRGLQNLTTLNVEGCSITAASVESISGIFSTFYSLKLHLKFSLLTGSNFVCPGSICYA*
• ORF Type: complete

Annotations of Ll_transcript_212019

• Blastp: F-box/LRR-repeat protein 14 from Homo with 31.71% of identity
• Blastx: F-box/LRR-repeat protein 14 from Mus with 31.71% of identity
• Eggnog: protein ubiquitination involved in ubiquitin-dependent protein catabolic process(ENOG410YK3H)
• Kegg: Link to kegg annotations (144699)
• CantataDB: Link to cantataDB annotations (CNT0000802)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453071.1)
• Pfam: Leucine Rich repeat (PF13516.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;