Protein coding transcript 250696

• Transcript: Ll_transcript_5722
• CDS coordinates: 1592-2035 (+)
• Peptide sequence: MHGIEQLANVQGLPTDRNTLNKLMTLNPGLNNQVNNNHNMVNCGALSGSAQAALELSNYQNILMRQNSTNSSPGPIQREGSSFNQVSQSPSSSLQGTATALIPGSMQNSTSRGFPSPNHLPPRLQHPQLQQRSLSANSLPIQNYSQGS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_5722

• Blastp: Probable transcriptional regulator SLK2 from Arabidopsis with 46.56% of identity
• Blastx: Probable transcriptional regulator SLK2 from Arabidopsis with 75.44% of identity
• Eggnog: NA(ENOG41126CV)
• Kegg: Link to kegg annotations (AT5G62090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431315.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;