Protein coding transcript 250699

• Transcript: Ll_transcript_5731
• CDS coordinates: 660-1136 (+)
• Peptide sequence: MPREYRFQSGMLMLEYAKAVQESVYEQLRVSREGHLRIIFTQDLKILSWEFCARRHEELLPRRSVVPQVLFCTLLQGFPPSWQPVFNLYMLGTPEWSTLHVEDTFLNKLVMCLLHLLCLFYLTKYIITPCFIICMLHCCVISLMFVYTTLFWRAQSGQ*
• ORF Type: complete

Annotations of Ll_transcript_5731

• Blastp: Probable transcriptional regulator SLK1 from Arabidopsis with 77.94% of identity
• Blastx: Probable transcriptional regulator SLK2 from Arabidopsis with 77.08% of identity
• Eggnog: NA(ENOG41126CV)
• Kegg: Link to kegg annotations (AT4G25520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431315.1)
• Pfam: LIM-domain binding protein (PF01803.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;