Protein coding transcript 251903

• Transcript: Ll_transcript_7477
• CDS coordinates: 1-699 (+)
• Peptide sequence: TLHHLHKLSLRQKTLLIARHLLSSLHHLTRHLISSSPPPLSTAMRQRQTDAVLLLLLFCDTQKHNPEALDAPYSEWRVNMCKLYSHNLLNLSCSSIIPFGTCFGTILIPYIEMVARCWSMVEALGCGGGGGGGKEVGEVAASVATVVALPTVEVVAGGKECVICKEEMIIGRDVCELPCQHLFHWSCILPWFGKKNTCPCCRFRLPSDDVFGEIQRLWEVLVKMGGKEYLGG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_7477

• Blastp: E3 ubiquitin-protein ligase SGR9, amyloplastic from Arabidopsis with 47.19% of identity
• Blastx: E3 ubiquitin-protein ligase SGR9, amyloplastic from Arabidopsis with 45.55% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT5G02750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443031.1)
• Pfam: Ring finger domain (PF13639.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;