Protein coding transcript 255508

• Transcript: Ll_transcript_35215
• CDS coordinates: 313-798 (+)
• Peptide sequence: MAVAENVGTKIGSSSQNLDNSVVSSDTTVEVEKSKPRNGSINGGDENMNGVFNHHFRAPNGNYKVQMGQIRNGFEGNGVQNQHMVVNNNGYGGVNGENGGESFKRDMRDLEELLSKLNPMAEEFVPPSLINNFGYLAAYDAGFGYPNNFVLPNNYGIVNGQN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_35215

• Blastp: Polyadenylate-binding protein-interacting protein 10 from Arabidopsis with 33.99% of identity
• Blastx: Polyadenylate-binding protein-interacting protein 10 from Arabidopsis with 32.03% of identity
• Eggnog: Rna-binding protein(COG0724)
• Kegg: Link to kegg annotations (AT3G49390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437323.1)
• Pfam: Ataxin-2 C-terminal region (PF07145.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;