Protein coding transcript 257032

• Transcript: Ll_transcript_51245
• CDS coordinates: 1484-2485 (+)
• Peptide sequence: MGNDDQSGNTVLAEPHVLSTINFNEQTFKSNIHNIKPTSNHSTIKMSIARTLLGTKPAPVMASFSARGPNPIQPSILKPDITAPGVNILAAYSEAASASNLPSDTRRGFPFNVLQGTSMSCPHIAGVAGLLKTLHTNWSPAAIKSAIMTTATTRDNTKRPIRDAFDKTLATPFAYGSGHVQPDFAMDPGLVYDITIVDYLNFLCASGYNQKLIAALRNSKKPFICSKSHSTVTDLNYPSITLPNLGLSAVNVTRVVTNVGTPSTYVASVYLPGFKVVVVPNSLSFKKVGEKKIFQVVVQATRVIPRGNYQFGELQWTNNVNHVVKSPIVARRK*
• ORF Type: complete

Annotations of Ll_transcript_51245

• Blastp: Subtilisin-like protease Glyma18g48580 from Soja with 64.43% of identity
• Blastx: Subtilisin-like protease Glyma18g48580 from Soja with 68.11% of identity
• Eggnog: peptidase (S8 and S53, subtilisin, kexin, sedolisin(COG1404)
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002900)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451659.1)
• Pfam: Subtilase family (PF00082.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;