Protein coding transcript 261584

• Transcript: Ll_transcript_256847
• CDS coordinates: 1-648 (+)
• Peptide sequence: LFLPGIDGVGLGLTLHHQKLGSIFDVWCLHIPVADRTPFTEFVKIVEKTVRSEHQRLPNRPIYLVGESLGGCLAMAVAAHIPDIDVVLILANPATSFGRSQLQLLTPLMEAMHGPLSLFPPEILSSISGDPLKLLDNLVRGFPLQNTAKELLEDFITFSGSLPVLANILPIETLQWKLKLLKSGSAYVNSRLHAIKAQTLILCRFMLFDLSILYHS
• ORF Type: internal

Annotations of Ll_transcript_256847

• Blastp: Acyltransferase-like protein At3g26840, chloroplastic from Arabidopsis with 49.53% of identity
• Blastx: Acyltransferase-like protein At3g26840, chloroplastic from Arabidopsis with 49.53% of identity
• Eggnog: Acyltransferase(COG0204)
• Kegg: Link to kegg annotations (AT3G26840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437419.1)
• Pfam: Serine aminopeptidase, S33 (PF12146.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;