Protein coding transcript 262267

• Transcript: Ll_transcript_14787
• CDS coordinates: 3-476 (+)
• Peptide sequence: NSFIWFGATPRVTLYDPELIRDAFNKINDFRKPNMNPLARLIASGLASHEGEKWSRHRRIINPAFNIEKIKVMLPIFSISCNDLISQWEGMLSSDGSCELDVWPFFQNLTSDVISRTAFGSSYEEGKRIFELQKEQAALTMKAALKSYIPRWRFLPIR
• ORF Type: internal

Annotations of Ll_transcript_14787

• Blastp: 11-oxo-beta-amyrin 30-oxidase from Glycyrrhiza with 60.26% of identity
• Blastx: 11-oxo-beta-amyrin 30-oxidase from Glycyrrhiza with 60.26% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (BAL45207)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430019.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;