Protein coding transcript 262608

• Transcript: Ll_transcript_13986
• CDS coordinates: 234-1103 (+)
• Peptide sequence: MADEPLYPIAVLIEELKNDDIQLRLNSIRRLSTIARALGEERTRRELIPFLIENNDDEDEVLLAMAEELGVFVPYVGGVEHASVLLPPLENLCTVEETCVRDKAVESLCRIGSQMRESDLVEYFIPLVKRLAAGEWFTARVSACGLFHIVYASAPETSKTELRSIYSQLCQDDMPMVRRSAASNLGKFAATVEYAHLKADVMSIFDDLTQDDQDSVRLLAVEGCAALGKLLEPQDCAAHILPVIVNFSQVNIGEWIKLLIIYNKFLFFITLISYPLETSCFSSHEFIIL*
• ORF Type: complete

Annotations of Ll_transcript_13986

• Blastp: Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform from Arabidopsis with 87.55% of identity
• Blastx: Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform from Arabidopsis with 87.25% of identity
• Eggnog: (Regulatory) subunit(ENOG410XQVI)
• Kegg: Link to kegg annotations (AT3G25800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441383.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;