Protein coding transcript 265170

• Transcript: Ll_transcript_86564
• CDS coordinates: 1-459 (+)
• Peptide sequence: VGLTKIQDQGWCSSSWAVSSTSVASDRFSIISQGMERVQLSTQNLLSCFKGRKIHETCKAGRVDQAWQFMKKFGVVDEPCFPYLGKEKSCTIKMRGDLRRANCAAPSSGRTQRYKVGPAYKLRNETDIMFDIMKSGPVQATMKVHHDFFVQIW
• ORF Type: internal

Annotations of Ll_transcript_86564

• Blastp: Uncharacterized peptidase C1-like protein F26E4.3 from Caenorhabditis with 40.91% of identity
• Blastx: Uncharacterized peptidase C1-like protein F26E4.3 from Caenorhabditis with 40.91% of identity
• Eggnog: tubulointerstitial nephritis(ENOG410YN9K)
• Kegg: Link to kegg annotations (CELE_F26E4.3)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017419031.1)
• Pfam: Papain family cysteine protease (PF00112.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;