Protein coding transcript 27323

• Transcript: Ll_transcript_433460
• CDS coordinates: 591-920 (+)
• Peptide sequence: MPEEELVDIKFRLYDGSDIGPFRYSAAATVDMLKQRIVSDWPKGKTVIPKAANEVKLINSGKILENNKTVGQCKVPFGEIGGGVIIMHVVVQPSLSKTKAGKFPQTSFY*
• ORF Type: complete

Annotations of Ll_transcript_433460

• Blastp: Membrane-anchored ubiquitin-fold protein 3 from Arabidopsis with 83.33% of identity
• Blastx: Membrane-anchored ubiquitin-fold protein 3 from Arabidopsis with 83.33% of identity
• Eggnog: membrane-anchored ubiquitin-fold protein(ENOG4111561)
• Kegg: Link to kegg annotations (AT4G24990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457753.1)
• Pfam: Ubiquitin-2 like Rad60 SUMO-like (PF13881.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;