Protein coding transcript 28005

• Transcript: Ll_transcript_434428
• CDS coordinates: 72-623 (+)
• Peptide sequence: MGSSKKLIEVLTDEQSPHKWCVSLGEEVFKRFFSQVNPTVHKVFGDGSLFSPMLFGKFFDPSDAFPLWEFESDIFLSHLRSTGQSTVDWSQTDEGYMLKAEIPGSGKNDNIEVHVDNGKVVEISGQWKQQRDSKANEWKCGQWWEYGYVRRLEMPEDADWKHIEAHIYSDIFLEIKIPKCDVA*
• ORF Type: complete

Annotations of Ll_transcript_434428

• Blastp: 21.7 kDa class VI heat shock protein from Arabidopsis with 56.42% of identity
• Blastx: 21.7 kDa class VI heat shock protein from Arabidopsis with 56.42% of identity
• Eggnog: kDa class VI heat shock(ENOG410YHRU)
• Kegg: Link to kegg annotations (AT5G54660)
• CantataDB: Link to cantataDB annotations (CNT0000798)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437133.1)
• Pfam: Hsp20/alpha crystallin family (PF00011.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;