| Transcript | Ll_transcript_315987 |
|---|---|
| CDS coordinates | 2178-2498 (+) |
| Peptide sequence | MSSYTLHRLCDYCSPSGLASVSCKYDVCTYFCTFNIAELIFYTFSWHLQMINGGFPIPVHSPNGMTNSATVPSTSTSMPQSQSHTVVVENPMSVDSNGKLVKLFCS* |
| ORF Type | complete |
| Blastp | Protein LOL2 from Oryza sativa with 65% of identity |
|---|---|
| Blastx | Protein LOL1 from Arabidopsis with 75% of identity |
| Eggnog | LSD1 zinc finger domain containing protein, expressed(ENOG4111MH5) |
| Kegg | Link to kegg annotations (4352767) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019435044.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer