Protein coding transcript 28489

• Transcript: Ll_transcript_316005
• CDS coordinates: 531-848 (+)
• Peptide sequence: MNILPQYKFDISTGELKQIRKPKPWKHTQPITKAQLMQLRDEFWDTAPHYGGRKEIWDALRAAVEADLSLAQAIVDSAGVIVQSSDMTVCYDERGNWFMLHSLIP*
• ORF Type: complete

Annotations of Ll_transcript_316005

• Blastp: Ubiquitin domain-containing protein 2 from Bos with 49.47% of identity
• Blastx: Ubiquitin domain-containing protein 2 from Homo with 40.28% of identity
• Eggnog: Ubiquitin domain containing(ENOG410XRPV)
• Kegg: Link to kegg annotations (541134)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456376.1)
• Pfam: Ubiquitin-binding domain (PF16455.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;