Protein coding transcript 28580

• Transcript: Ll_transcript_316366
• CDS coordinates: 1-777 (+)
• Peptide sequence: ILALLKTHQFYAKQSKCVFGVASVDYLGHILSKEGVRPDPAKIQAVVDWPIPCSLTTLRGFLGLTGFYRRFIRQYATHAAPLTDLLKQGKFLWSTEAQLAFTTMKNIMITTHVLALPDFSQSFDVETDASAIAIGAVLSQAGHPIAYFSKKMSGRMQAASTYVREMYAVTESVKKWRQYLLGRSFRIFTDQKSLKHLLTQTFQTTEQQKWATKLQGFEFEIIYRPGKENRAADALSRCHSKDVTILCSLSSPVPALLD*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_316366

• Blastp: Retrovirus-related Pol polyprotein from transposon 297 from Sophophora with 40.18% of identity
• Blastx: Transposon Tf2-11 polyprotein from Schizosaccharomyces with 32.25% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450597.1)
• Pfam: N-terminal domain of Peptidase_S41 in eukaryotic IRBP (PF11918.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;