Protein coding transcript 30028

• Transcript: Ll_transcript_513282
• CDS coordinates: 370-900 (+)
• Peptide sequence: MITVLQLARLPNIKVATVLLCCAFVYDIFWVFISPKIFQKSVMITVAKGDNAGGEAIPMLLRFPRLTDPWGGYDMIGFGDILFPGLLVSFARRFDKETNKGILGGYFLWLVIGYAMGLCFTYMGLYMMKGHGQPALLYLVPCTLGVTVILALIRGDLKTLWSYNPDSSSAGADSDA*
• ORF Type: complete

Annotations of Ll_transcript_513282

• Blastp: Signal peptide peptidase-like 5 from Arabidopsis with 70.76% of identity
• Blastx: Signal peptide peptidase-like 5 from Arabidopsis with 73.05% of identity
• Eggnog: signal peptide(ENOG410ZP52)
• Kegg: Link to kegg annotations (AT1G05820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441583.1)
• Pfam: Signal peptide peptidase (PF04258.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;