Protein coding transcript 30739

• Transcript: Ll_transcript_511821
• CDS coordinates: 3-632 (+)
• Peptide sequence: LMPKQHLSGELHFSNNTPFCNASAEALNDIRAGVFSSSKAQYQTPTFEEKPISPSTQLSKLKKDESPDTISVGKKSGCEPAFKRQRIETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIDYIKFLHDQVTVLNTSYLKKGAPIQHQQRCDNLNDSEGPKQDLRSRGLCLVPISSTFPVVNETSVDFWTLTFGGAFISS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_511821

• Blastp: Transcription factor bHLH123 from Arabidopsis with 51.22% of identity
• Blastx: Transcription factor bHLH123 from Arabidopsis with 51.22% of identity
• Eggnog: Transcription factor(ENOG4111AEF)
• Kegg: Link to kegg annotations (AT3G20640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424710.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;