Protein coding transcript 33315

• Transcript: Ll_transcript_372204
• CDS coordinates: 438-830 (+)
• Peptide sequence: MAHALHPNYMDKHEENHQPRLHGGLVIKLNANQRYATNAVTSFIFREIASKHNLPVQDFVVRNDMPCGSTIGPILASGLGIRTVDVGAPQLSMHSIREMCAVDDVKYSYEHFKAFFQEFSHLDEKITVDI*
• ORF Type: complete

Annotations of Ll_transcript_372204

• Blastp: Probable aspartyl aminopeptidase from Ricinus with 91.54% of identity
• Blastx: Probable aspartyl aminopeptidase from Ricinus with 90.85% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437158.1)
• Pfam: Aminopeptidase I zinc metalloprotease (M18) (PF02127.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;