Protein coding transcript 36027

• Transcript: Ll_transcript_311664
• CDS coordinates: 121-444 (+)
• Peptide sequence: MGTLGRVIYTVGFWIRETGQAVDRLGSRLQGSYYFQEQLSRHRTLMNIFDKAPTVDKDAFVAPSASVIGDVHIGKGSSIWYGSVLRGNQFITLLQLYVNRLSYFRIR*
• ORF Type: complete

Annotations of Ll_transcript_311664

• Blastp: Gamma carbonic anhydrase 1, mitochondrial from Arabidopsis with 84.09% of identity
• Blastx: Gamma carbonic anhydrase 1, mitochondrial from Arabidopsis with 83.72% of identity
• Eggnog: Transferase(COG0663)
• Kegg: Link to kegg annotations (AT1G19580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416688.1)
• Pfam: Bacterial transferase hexapeptide (six repeats) (PF00132.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;