Protein coding transcript 39863

• Transcript: Ll_transcript_474825
• CDS coordinates: 545-1063 (+)
• Peptide sequence: MWSLDQFRSLLNRSNEDSKLKELLQMDNLVVFLHLLGCDSNGHAHRPFSSIYLNNVKVVDHVAESVYNLVEDYFKDNRTAYIFTADHGMSDKGSHGDGHPSNTDTPLVAWGAGVKYPRPVSSSNHSDSGFRFVDDHVHDSPTPTEWGLHGIERVDVNQADIAPLMVVNFIFP*
• ORF Type: complete

Annotations of Ll_transcript_474825

• Blastp: GPI ethanolamine phosphate transferase 1 from Aspergillus with 45.4% of identity
• Blastx: GPI ethanolamine phosphate transferase 1 from Homo with 46.86% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AOR_1_540054)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453347.1)
• Pfam: Sulfatase (PF00884.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;