Protein coding transcript 4114

• Transcript: Ll_transcript_428753
• CDS coordinates: 795-1355 (+)
• Peptide sequence: MCRASALFVGVYEPMKQKLLRVFPENLSAFAHLTAGALGGIAASLIRVPTEVVKQRMQTRQFTSASGAVRYIASKEGFRGLYAGYGSFLLRDLPFDAIQFCIYEQIRIGYKLAARRDLNDPENALIGAFAGALTGAITTPLDVIKTRLMIQGSGNQYKGIVDCVQTIIKEEGPSALLKVCFLFHTM*
• ORF Type: complete

Annotations of Ll_transcript_428753

• Blastp: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial from Arabidopsis with 84% of identity
• Blastx: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial from Arabidopsis with 84% of identity
• Eggnog: mitochondrial carrier protein(ENOG4110BII)
• Kegg: Link to kegg annotations (AT4G39460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462507.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;