Protein coding transcript 42532

• Transcript: Ll_transcript_527131
• CDS coordinates: 184-951 (+)
• Peptide sequence: MKHTLCGHMSAISLVAWSPDDTKLLTIGNTEVLKLWDVETGTCKLTFGNLDFVVSSCAWLPNSKQFVCGYSDPEKGICMWDCDGNEIKAWRGMGMPKVVDIAVTPDGEYLISIFMDKEIRVLHMETNAERIISEEHSITSLSVSGDSKFFIVNLNSQEIHMWDVAGKWNKPLCFMGHKQCKYVIRSCFGGFNSTFIASGSENAQVYIWNSRSSTPIEVLSGHSLTVNCVSWNPKRPHMLASASDDFSIRIWGPSS*
• ORF Type: complete

Annotations of Ll_transcript_527131

• Blastp: WD repeat-containing protein 26 from Homo with 39.76% of identity
• Blastx: WD repeat-containing protein 26 from Silurana with 38.78% of identity
• Eggnog: WD repeat domain 26(ENOG410XQ2U)
• Kegg: Link to kegg annotations (80232)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432762.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;