Protein coding transcript 42651

• Transcript: Ll_transcript_525151
• CDS coordinates: 1-795 (+)
• Peptide sequence: SDVARNAGLQRCGKSCRLRWINYLRPDLKRGAFSPQEEELIIHLHSLLGNRWSQIAACLPGRTDNEIKNFWNSTIKKRLKNLSSTTESSYDPTNKDLNINIVGFTSTTQHYQHSEFMPMLNSSSPSSTQETVLNTIIDRLPMLEHGIMNMPVAGGFFNGAIDNNKDFYLESGVFGSVNFGAEVDMFVPPLECVRTTSEHNIKVENACNNIATNNSYLNICNNKIRGEIRDGVEILFQEELVMGEWDMEELMKDVSSFPFLDFSS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_525151

• Blastp: Transcription factor MYB83 from Arabidopsis with 41% of identity
• Blastx: Transcription factor MYB46 from Arabidopsis with 43.68% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT3G08500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413842.1)
• Pfam: Myb-like DNA-binding domain (PF13921.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;