Protein coding transcript 43719

• Transcript: Ll_transcript_360229
• CDS coordinates: 534-884 (+)
• Peptide sequence: MKQRERNLIQSNGVAADAVVALDGSGNYSNVMDAVEAAPDYSMKRYVIYIKKGVYNEYVEIKKKKWNIMIIGDGINATVITGNRSFIDGWTTFRSATFGKNMLLLYSFSFFPFSSF*
• ORF Type: complete

Annotations of Ll_transcript_360229

• Blastp: Pectinesterase/pectinesterase inhibitor PPE8B from Prunus with 70.41% of identity
• Blastx: Pectinesterase/pectinesterase inhibitor PPE8B from Prunus with 68.72% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455433.1)
• Pfam: Pectinesterase (PF01095.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;