Protein coding transcript 45657

• Transcript: Ll_transcript_374527
• CDS coordinates: 422-742 (+)
• Peptide sequence: MAQILAPPTQWRIRGTKTSPNASPITSNMWSSLLLRQNKKVAPISSTKFRVMAIKSEGGTINRLEGLLNLDVSPYTDKTIAEYIWYFTPSALFVSHINYLFFPASA*
• ORF Type: complete

Annotations of Ll_transcript_374527

• Blastp: Glutamine synthetase leaf isozyme, chloroplastic from Phaseolus with 72.94% of identity
• Blastx: Glutamine synthetase leaf isozyme, chloroplastic from Phaseolus with 92.42% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (PHAVU_006G155800g)
• CantataDB: Link to cantataDB annotations (CNT0002361)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425876.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;