Protein coding transcript 46780

• Transcript: Ll_transcript_443276
• CDS coordinates: 3-494 (+)
• Peptide sequence: PVECREKWMHASAVIGGKFYAMADRGGMVFDPRSGVWESVGREMDNGWRGRACVVDEVLYCYDYLGKIKGFDVRSGVWKEVKGLGKGLLPRFLCGATMANVGGKLVVVWECDGNGKEMEVWCAEIEVKMDGTNGELLGEVGWIEKVLCVPKGSSIVQCCSVTL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_443276

• Blastp: F-box/kelch-repeat protein SKIP6 from Arabidopsis with 53.94% of identity
• Blastx: F-box/kelch-repeat protein SKIP6 from Arabidopsis with 53.94% of identity
• Eggnog: Kelch repeat-containing F-box family protein(ENOG4110X8D)
• Kegg: Link to kegg annotations (AT2G21950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430235.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;