Protein coding transcript 63886

• Transcript: Ll_transcript_437418
• CDS coordinates: 204-644 (+)
• Peptide sequence: MANASGFFSLRIQPSMPIHQFLCLASTQGAHITTSPSQSRLPRLVSQGCKLVGCGSAVPSLEISNDDLSKFVETSDEWISSRTGIRRRRVLSGKDNLTNLAAEAARKALEMANVDPDDLDLILMCTSTPEDLFGSAPQVCVQDVSY*
• ORF Type: complete

Annotations of Ll_transcript_437418

• Blastp: 3-oxoacyl-[acyl-carrier-protein] synthase 3 A, chloroplastic from Cuphea with 58.23% of identity
• Blastx: 3-oxoacyl-[acyl-carrier-protein] synthase III, chloroplastic from Arabidopsis with 82.52% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447643.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;