Protein coding transcript 65794

• Transcript: Ll_transcript_329538
• CDS coordinates: 1146-1901 (+)
• Peptide sequence: MASSLLLPLSTPSAPFYLFDNSAAKSSFLHSTTNLFPSFPKSTTKVSRRCFISPSAKSSFDHIPKQFRKDNLKDGMMDNYKNAPQYLYGLSPSQIDMFMTEDNPIRQQTERVTEESISSAKNYLDHGGMWSHSCMGNNGPSKYSMSVSMYRGGGGGRGAGRPRTAPPDLPSLLLDARICYLGMPIVPAVAELLVAQFMWLDYDNPKKPIYLYINSSGTQNEKNETVGSETEAYSIADMMSVSFYHESFARL*
• ORF Type: complete

Annotations of Ll_transcript_329538

• Blastp: ATP-dependent Clp protease proteolytic subunit-related protein 1, chloroplastic from Arabidopsis with 65.06% of identity
• Blastx: ATP-dependent Clp protease proteolytic subunit-related protein 1, chloroplastic from Arabidopsis with 62.38% of identity
• Eggnog: Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins (By similarity)(COG0740)
• Kegg: Link to kegg annotations (AT1G49970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428782.1)
• Pfam: Clp protease (PF00574.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;