Protein coding transcript 68605

• Transcript: Ll_transcript_292017
• CDS coordinates: 163-696 (+)
• Peptide sequence: MASTLPNASFTLNNASFSDGKTYVGVPLMPTNLKFCSSSKSRQSSHLFAVKASNSQNGPGFLKKLGLTDAQCEAAVVAGNVPHAPPVPPKPAAPIGTPVVPSLPLSRRPRRNRRSPVLREAFQETSLSPANFVYPLFIHEGEQDTPIGAMPGCYRLGWRHGLVEEVFICHYFCTLYS*
• ORF Type: complete

Annotations of Ll_transcript_292017

• Blastp: Delta-aminolevulinic acid dehydratase 1, chloroplastic from Arabidopsis with 62.28% of identity
• Blastx: Delta-aminolevulinic acid dehydratase 1, chloroplastic from Arabidopsis with 62.28% of identity
• Eggnog: delta-aminolevulinic acid dehydratase(COG0113)
• Kegg: Link to kegg annotations (AT1G69740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415140.1)
• Pfam: Delta-aminolevulinic acid dehydratase (PF00490.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;