Protein coding transcript 68774

• Transcript: Ll_transcript_468216
• CDS coordinates: 214-960 (+)
• Peptide sequence: MVEACVSTTFSVALIVGVVIWLWRILNSYWFRPKMLERLLREQGLKGNPYRPLSGDINDLFKSRKEAESKPMPISDDIIPRVSSYLYQSVNKYGKNSFIWFGATPRVTLYDPELIRDAFNKINDFRKPNMNPFARLIASGLASHEGEKWSRHRRIINPAFNIEKIKIMLPIFSISCNDLISQWEGMLSSDGSCELDVWPFFQNLTSDVISRTAFGSSYEEGKRIFELQKEQAALTMKAALKSYIPGWR*
• ORF Type: complete

Annotations of Ll_transcript_468216

• Blastp: Cytochrome P450 72A15 from Arabidopsis with 53.47% of identity
• Blastx: Cytochrome P450 72A15 from Arabidopsis with 53.47% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (AT3G14690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430019.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;