Protein coding transcript 69968

• Transcript: Ll_transcript_467953
• CDS coordinates: 143-613 (+)
• Peptide sequence: MATDFSSIPIINISALLAKSDDPKMGEDPCVLEVVRQLDKACTEAGFFYVKGHGIPETLLGAVKDITRRFFELPYEEKAQIKMTPATGFRGYQMIGENITKGVPDMHEAIDCYREVTKGMYGDLGKQMEGCNQWYVVLAFSCLMLVVFLHPFLNFR*
• ORF Type: complete

Annotations of Ll_transcript_467953

• Blastp: Probable 2-oxoglutarate-dependent dioxygenase At3g50210 from Arabidopsis with 69.4% of identity
• Blastx: Probable 2-oxoglutarate-dependent dioxygenase At3g50210 from Arabidopsis with 69.4% of identity
• Eggnog: 2OGFe(II) oxygenase(COG3491)
• Kegg: Link to kegg annotations (AT3G50210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446812.1)
• Pfam: non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;